MEME — Multiple EM for Motif Elicitation

MEME is a tool for discovering motifs in a group of related DNA or protein sequences.

A motif is a sequence pattern that occurs repeatedly in a group of related protein or DNA sequences. MEME represents motifs as position-dependent letter-probability matrices which describe the probability of each possible letter at each position in the pattern. Individual MEME motifs do not contain gaps. Patterns with variable-length gaps are split by MEME into two or more separate motifs.

MEME takes as input a group of DNA or protein sequences (the training set) and outputs as many motifs as requested. MEME uses statistical modeling techniques to automatically choose the best width, number of occurrences, and description for each motif.

MEME outputs its results primarily as a hypertext (HTML) document named meme.html. This is placed in a directory named meme_out/". You can select for the directory to have a different name. MEME also outputs machine-readable (XML) a plain-text versions of its output, named meme.xml and meme.txt, respectively. These are placed in the same output directory as meme.html.

The MEME results consist of:

The version of MEME and the date it was released.
The reference to cite if you use MEME in your research.
A description of the sequences you submitted (the "training set") showing the name, "weight" and length of each sequence.
The command line summary detailing the parameters with which you ran MEME.
Information on each of the motifs MEME discovered, including:
1. A summary line showing the width, number of occurrences, log likelihood ratio and statistical significance of the motif.
2. A sequence "LOGO" illustrating the motif, along with links to publication-ready versions of the LOGO (postscript and PNG formats).
3. The occurrences of the motif sorted by p-value and aligned with each other.
4. Block diagrams of the occurrences of the motif within each sequence in the training set.
5. The motif in BLOCKS format: buttons for viewing the motif in various formats and for submitting it to the BLOCKS multiple alignment processor.
6. A position-specific scoring matrix (PSSM) for use in scanning sequence databases and a button for submitting the motif to the MAST scanning program.
7. The position specific probability matrix (PSPM) describing the motif and a button for comparing the motif to known motifs.
8. A regular expression describing the motif.
A summary of motifs showing an optimized (non-overlapping) tiling of all of the motifs onto each of the sequences in the training set.
The reason why MEME stopped and the name of the CPU on which it ran.
This explanation of how to interpret MEME results.

REQUIRED ARGUMENTS:

<dataset> The name of the file containing the training set sequences. If <dataset> is the word stdin, MEME reads from standard input.

The sequences in the dataset should be in Pearson/FASTA format. For example:
```
          >ICYA_MANSE INSECTICYANIN A FORM (BLUE BILIPROTEIN)
          GDIFYPGYCPDVKPVNDFDLSAFAGAWHEIAK
          LPLENENQGKCTIAEYKYDGKKASVYNSFVSNGVKEYMEGDLEIAPDA
          >LACB_BOVIN BETA-LACTOGLOBULIN PRECURSOR (BETA-LG) 
          MKCLLLALALTCGAQALIVTQTMKGLDI
          QKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKW
      
```
Sequences start with a header line followed by sequence lines. A header line has the character ">" in position one, followed by an unique name without any spaces, followed by (optional) descriptive text. After the header line come the actual sequence lines. Spaces and blank lines are ignored. Sequences may be in capital or lowercase or both.

MEME uses the first word in the header line of each sequence, truncated to 24 characters if necessary, as the name of the sequence. This name must be unique. Sequences with duplicate names will be ignored. (The first word in the title line is everything following the ">" up to the first blank.)

Sequence weights may be specified in the dataset file by special header lines where the unique name is "WEIGHTS" (all caps) and the descriptive text is a list of sequence weights. Sequence weights are numbers in the range 0 < w <= 1. All weights are assigned in order to the sequences in the file. If there are more sequences than weights, the remainder are given weight one. Weights must be greater than zero and less than or equal to one. Weights may be specified by more than one "WEIGHT" entry which may appear anywhere in the file. When weights are used, sequences will contribute to motifs in proportion to their weights. Here is an example for a file of three sequences where the first two sequences are very similar and it is desired to down-weight them:
```
          >WEIGHTS 0.5 .5 1.0 
          >seq1
          GDIFYPGYCPDVKPVNDFDLSAFAGAWHEIAK
          >seq2
          GDMFCPGYCPDVKPVGDFDLSAFAGAWHELAK
          >seq3
          QKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKW
      
```

OPTIONAL ARGUMENTS:

MEME has a large number of optional inputs that can be used to fine-tune its behavior. To make these easier to understand they are divided into the following categories:

OUTPUT DESTINATION — control where MEME places its output
ALPHABET — control the alphabet for the motifs (patterns) that MEME will search for
DISTRIBUTION — control how MEME assumes the occurrences of the motifs are distributed throughout the training set sequences
SEARCH — control how MEME searches for motifs
SYSTEM — the -p <np> argument causes a version of MEME compiled for a parallel CPU architecture to be run. (By placing <np> in quotes you may pass installation specific switches to the 'mpirun' command. The number of processors to run on must be the first argument following -p).

In what follows, <n> is an integer, <a> is a decimal number, and <string> is a string of characters.

OUTPUT DESTINATION

By default MEME writes its results to a directory named meme_out/, which is created if it doesn't exist. The main results include file is meme.html. You can specify that a different directory be created or used for results. You can also specify that MEME create only a text file.

-o <output dir> — Name of directory for output files; will not replace existing directory.
-oc <output dir> — Name of directory for output files; will replace existing directory.
-text — Output in text format only to standard output.

ALPHABET

MEME accepts either DNA or protein sequences, but not both in the same run. By default, sequences are assumed to be protein. The sequences must be in FASTA format.

DNA sequences must contain only the letters "ACGT", plus the ambiguous letters "BDHKMNRSUVWY*-". Protein sequences must contain only the letters "ACDEFGHIKLMNPQRSTVWY", plus the ambiguous letters "BUXZ*-".

MEME converts all ambiguous letters to "X", which is treated as "unknown".

-dna — Assume sequences are DNA; default: protein sequences.
-protein — Assume sequences are protein.

DISTRIBUTION

If you know how occurrences of motifs are distributed in the training set sequences, you can specify it with the following optional switches. The default distribution of motif occurrences is assumed to be zero or one occurrence of per sequence.

If you know how occurrences of motifs are distributed in the training set

-mod <string> — The type of distribution to assume.
- oops — One Occurrence Per Sequence MEME assumes that each sequence in the dataset contains exactly one occurrence of each motif. This option is the fastest and most sensitive but the motifs returned by MEME may be "blurry" if any of the sequences is missing them.
- zoops — Zero or One Occurrence Per Sequence MEME assumes that each sequence may contain at most one occurrence of each motif. This option is useful when you suspect that some motifs may be missing from some of the sequences. In that case, the motifs found will be more accurate than using the first option. This option takes more computer time than the first option (about twice as much) and is slightly less sensitive to weak motifs present in all of the sequences.
- anr — Any Number of Repetitions MEME assumes each sequence may contain any number of non-overlapping occurrences of each motif. This option is useful when you suspect that motifs repeat multiple times within a single sequence. In that case, the motifs found will be much more accurate than using one of the other options. This option can also be used to discover repeats within a single sequence. This option takes the much more computer time than the first option (about ten times as much) and is somewhat less sensitive to weak motifs which do not repeat within a single sequence than the other two options.

SEARCH

OBJECTIVE FUNCTION
MEME uses an objective function on motifs to select the "best" motif. The objective function is based on the statistical significance of the log likelihood ratio (LLR) of the occurrences of the motif. The E-value of the motif is an estimate of the number of motifs (with the same width and number of occurrences) that would have equal or higher log likelihood ratio if the training set sequences had been generated randomly according to the (0-order portion of the) background model.

MEME searches for the motif with the smallest E-value. It searches over different motif widths, numbers of occurrences, and positions in the training set for the motif occurrences. The user may limit the range of motif widths and number of occurrences that MEME tries using the switches described below. In addition, MEME trims the motif (using a dynamic programming multiple alignment) to eliminate any positions where there is a gap in any of the occurrences.

The log likelihood ratio of a motif is llr = log (Pr(sites | motif) / Pr(sites | back)) and is a measure of how different the sites are from the background model. Pr(sites | motif) is the probability of the occurrences given the a model consisting of the position-specific probability matrix (PSPM) of the motif. (The PSPM is output by MEME). Pr(sites | back) is the probability of the occurrences given the background model. The background model is an n-order Markov model. By default, it is a 0-order model consisting of the frequencies of the letters in the training set. A different 0-order Markov model or higher order Markov models can be specified to MEME using the -bfile option described below.

The E-value reported by MEME is actually an approximation of the E-value of the log likelihood ratio. (An approximation is used because it is far more efficient to compute.) The approximation is based on the fact that the log likelihood ratio of a motif is the sum of the log likelihood ratios of each column of the motif. Instead of computing the statistical significance of this sum (its p-value), MEME computes the p-value of each column and then computes the significance of their product. Although not identical to the significance of the log likelihood ratio, this easier to compute objective function works very similarly in practice.

The motif significance is reported as the E-value of the motif. The statistical significance of a motif is computed based on:
1. the log likelihood ratio,
2. the width of the motif,
3. the number of occurrences,
4. the 0-order portion of the background model,
5. the size of the training set, and
6. the type of model (oops, zoops, or anr, which determines the number of possible different motifs of the given width and number of occurrences).
MEME searches for motifs by performing Expectation Maximization (EM) on a motif model of a fixed width and using an initial estimate of the number of sites. It then sorts the possible sites according to their probability according to EM. MEME then and calculates the E-values of the first n sites in the sorted list for different values of n. This procedure (first EM, followed by computing E-values for different numbers of sites) is repeated with different widths and different initial estimates of the number of sites. MEME outputs the motif with the lowest E-value.

NUMBER OF MOTIFS
- -nmotifs <n> — The number of *different* motifs to search for. MEME will search for and output <n> motifs. Default: 1
- -evt <p> — Quit looking for motifs if E-value exceeds <p>. Default: infinite (so by default MEME never quits before -nmotifs <n> have been found.)

NUMBER OF MOTIF OCCURRENCES
- -nsites <n>
  -minsites <n>
  -maxsites <n>
  The (expected) number of occurrences of each motif. If -nsites is given, only that number of occurrences is tried. Otherwise, numbers of occurrences between -minsites and -maxsites are tried as initial guesses for the number of motif occurrences. These switches are ignored if mod = oops.
  Defaults:
```
             -minsites : 2
             -maxsites :
               zoops : number of sequences
               anr   : MIN(5*(number of sequences), 50) 
```
- -wnsites <n> — The weight on the prior on nsites. This controls how strong the bias towards motifs with exactly nsites sites (or between minsites and maxsites sites) is. It is a number in the range [0..1). The larger it is, the stronger the bias towards motifs with exactly nsites occurrences is.
  Default: 0.8

MOTIF WIDTH
- -w <n>
  -minw <n>
  -maxw <n>
  
  The width of the motif(s) to search for. If -w is given, only that width is tried. Otherwise, widths between -minw and -maxw are tried.
  Default: -minw 8, -maxw 50 (defined in user.h)
  
  Note: If <n> is less than the length of the shortest sequence in the dataset, <n> is reset by MEME to that value.
- -nomatrim
  -wg <a>
  -ws <a>
  -noendgaps
  
  These switches control trimming (shortening) of motifs using the multiple alignment method. Specifying -nomatrim causes MEME to skip this and causes the other switches to be ignored. MEME finds the best motif found and then trims (shortens) it using the multiple alignment method (described below). The number of occurrences is then adjusted to maximize the motif E-value, and then the motif width is further shortened to optimize the E-value.
  
  The multiple alignment method performs a separate pairwise alignment of the site with the highest probability and each other possible site. (The alignment includes width/2 positions on either side of the sites.) The pairwise alignment is controlled by the switches:
  -wg <a> (gap cost; default: 11),
  -ws <a> (space cost; default 1), and,
  -noendgaps (do not penalize endgaps; default: penalize endgaps).
  
  The pairwise alignments are then combined and the method determines the widest section of the motif with no insertions or deletions. If this alignment is shorter than <minw>, it tries to find an alignment allowing up to one insertion/deletion per motif column. This continues (allowing up to 2, 3 ... insertions/deletions per motif column) until an alignment of width at least <minw> is found.
BACKGROUND MODEL
- -bfile <bfile> — The name of the file containing the background model for sequences. The background model is the model of random sequences used by MEME. The background model is used by MEME
  1. during EM as the "null model",
  2. for calculating the log likelihood ratio of a motif,
  3. for calculating the significance (E-value) of a motif, and,
  4. for creating the position-specific scoring matrix (log-odds matrix).
By default, the background model is a 0-order Markov model based on the letter frequencies in the training set.

Markov models of any order can be specified in <bfile> by listing frequencies of all possible tuples of length up to order+1.

Note that MEME uses only the 0-order portion (single letter frequencies) of the background model for purposes 3) and 4), but uses the full-order model for purposes 1) and 2), above.

Example: To specify a 1-order Markov background model for DNA, <bfile> might contain the following lines. Note that optional comment lines are marked by "#" and are ignored by MEME.
```
                # tuple   frequency_non_coding
                a       0.324
                c       0.176
                g       0.176
                t       0.324
                # tuple   frequency_non_coding
                aa      0.119
                ac      0.052
                ag      0.056
                at      0.097
                ca      0.058
                cc      0.033
                cg      0.028
                ct      0.056
                ga      0.056
                gc      0.035
                gg      0.033
                gt      0.052
                ta      0.091
                tc      0.056
                tg      0.058
                tt      0.119
          
```
Sample -bfile files are given in directory tests: tests/nt.freq (DNA), and tests/na.freq (amino acid).
POSITION-SPECIFIC PRIORS
- -psp <pspfile> — position-specific prior (PSP)
  These priors allow the user to bias the search for motifs. They give a position-specific prior distribution on the location of motif sites in sequence(s) in the input dataset. The MEME PSP format used in the pspfile includes the name of the sequence for which a prior distribution corresponds. Sequences not named in the pspfile are given uniform prior distributions on site locations by MEME.
  
  A PSP must be created for a specific width of motif, w. This width must be specified for each entry in the pspfile, and must be the same for all entries. If MEME varies the motif width during computation, MEME renormalises the PSP for each sequence.
  
  The pspfile should be in MEME PSP format, which is similar to FASTA format. For example:
```
    >ICYA_MANSE 4
    0.075922 0.070764 0.082380 0.030292 0.025101 0.043139 0.032963
    0.086047 0.057445 0.000000 0.000000 0.000000

    >LACB_BOVIN 4
    0.107099 0.099822 0.116208 0.042731 0.035408 0.060854 0.046499
    0.000000 0.000000 0.000000
             
```
  Each entry should start with a header line consisting of a sequence name followed by the width, w, of the PSP prior. The sequence name must the name of a sequence in the FASTA file input to MEME. Any other text on the header line after the name and w is ignored by MEME. The following lines contain one number for each position in the identically-named named FASTA sequence, where the number gives the prior probability of a motif site at that position in the sequence (or in the reverse complement if -revcomp is specified). The last w-1 numbers for each entry should be 0 (shown in blue in the example), since a motif of that width cannot start in those positions. All numbers for an entry must be in the range [0,1], and must sum to a number no greater than 1. If they sum to less than 1 and -mod oops is specified, MEME will rescale the numbers so that they sum to 1.
  
  For more detail on generation of PSP data, see documentation of our simple tool psp-gen.
DNA PALINDROMES AND STRANDS
- -revcomp — motifs occurrences may be on the given DNA strand or on its reverse complement.
  Default: look for DNA motifs only on the strand given in the training set.
- -pal — Choosing -pal causes MEME to look for palindromes in DNA datasets.
MEME averages the letter frequencies in corresponding columns of the motif (PSPM) together. For instance, if the width of the motif is 10, columns 1 and 10, 2 and 9, 3 and 8, etc., are averaged together. The averaging combines the frequency of A in one column with T in the other, and the frequency of C in one column with G in the other. If neither option is not chosen, MEME does not search for DNA palindromes.
EM ALGORITHM
- -maxiter <n> — The number of iterations of EM to run from any starting point. EM is run for <n> iterations or until convergence (see -distance, below) from each starting point. Default: 50
- -distance <a> — The convergence criterion. MEME stops iterating EM when the change in the motif frequency matrix is less than <a> (Change is the euclidean distance between two successive frequency matrices.) Default: 0.001
- -prior <string> — The prior distribution on the model parameters:
  - dirichlet — simple Dirichlet prior. This is the default for -dna. It is based on the non-redundant database letter frequencies.
  - dmix — mixture of Dirichlets prior. This is the default for -protein.
  - mega — extremely low variance dmix; variance is scaled inversely with the size of the dataset.
  - megap — mega for all but last iteration of EM; dmix on last iteration.
  - addone — add +1 to each observed count
- -b <a> — The strength of the prior on model parameters: <a> = 0 means use intrinsic strength of prior for prior = dmix.
  Defaults:
  - 0.01 — if prior = dirichlet
  - 0 — if prior = dmix
- -plib <string> — The name of the file containing the Dirichlet prior in the format of file prior30.plib.

SELECTING STARTS FOR EM
The default is for MEME to search the dataset for good starts for EM. How the starting points are derived from the dataset is specified by the following switches.

The default type of mapping MEME uses is:
- -spmap uni — for -dna
- -spmap pam — for -protein
- -spfuzz <a> — The fuzziness of the mapping. Possible values are greater than 0. Meaning depends on -spmap, see below.
- -spmap <string> — The type of mapping function to use.
  - uni — Use add-<a> prior when converting a substring to an estimate of theta.
    Default -spfuzz <a> 0.5
  - pam — Use columns of PAM <a> matrix when converting a substring to an estimate of theta.
    Default -spfuzz <a> 120 (PAM 120)
  Other types of starting points can be specified using the following switches.
- -cons <string> — Override the sampling of starting points and just use a starting point derived from <string>. This is useful when an actual occurrence of a motif is known and can be used as the starting point for finding the motif.

BRANCHING SEARCH ON EM STARTS
The search for good EM starting points can be improved by using branching search.

Branching search begins with a fixed-sized heap of best EM starts identified during the search of subsequences from the dataset. These starts are also called "seeds". The fixed-sized heap of seeds is used as the "branch_heap" during the first iteration of branching search.

For each iteration of branching search, all seeds in the current branch_heap are considered. All seeds in the ball within hamming distance 1 of a given seed are evaluated and added to a new heap. The ball of new seeds is generated by mutating each character of the initial seed to each alternative character in the alphabet.

After the ball for every branch_heap seed has been evaluated, the seeds in the resulting new heap are added to the heap of best EM starts. The new heap is then used as the branch_heap for the next iteration of branching search.

By default MEME does not perform x-branching.
- -x_branch — Perform x-branching.
- -bfactor <bf> — The number of iterations of branching search. The default number of branching iterations is three.
- -heapsize <hs> — The maximum size of the heaps used during branching search. The default heap size is 64.

EXAMPLES:

The following examples use data files provided in this release of MEME. MEME writes its output to standard output, so you will want to redirect it to a file in order for use with MAST.

A simple DNA example:
```
      meme crp0.s -dna -mod oops -pal
      
```
MEME looks for a single motif in the file crp0.s which contains DNA sequences in FASTA format. The OOPS model is used so MEME assumes that every sequence contains exactly one occurrence of the motif. The palindrome switch is given so the motif model (PSPM) is converted into a palindrome by combining corresponding frequency columns. MEME automatically chooses the best width for the motif in this example since no width was specified.
Searching for motifs on both DNA strands:
```
      meme crp0.s -dna -mod oops -revcomp
      
```
This is like the previous example except that the -revcomp switch tells MEME to consider both DNA strands, and the -pal switch is absent so the palindrome conversion is omitted. When DNA uses both DNA strands, motif occurrences on the two strands may not overlap. That is, any position in the sequence given in the training set may be contained in an occurrence of a motif on the positive strand or the negative strand, but not both.
A fast DNA example:
```
      meme crp0.s -dna -mod oops -revcomp -w 20
      
```
This example differs from example 1) in that MEME is told to only consider motifs of width 20. This causes MEME to execute about 10 times faster. The -w switch can also be used with protein datasets if the width of the motifs is known in advance.
Using a higher-order background model:
```
      meme INO_up800.s -dna -mod anr -revcomp -bfile yeast.nc.6.freq
      
```
In this example we use -mod anr and -bfile yeast.nc.6.freq. This specifies that
a) the motif may have any number of occurrences in each sequence, and,
b) the Markov model specified in yeast.nc.6.freq is used as the background model. This file contains a fifth-order Markov model for the non-coding regions in the yeast genome.

Using a higher order background model can often result in more sensitive detection of motifs. This is because the background model more accurately models non-motif sequence, allowing MEME to discriminate against it and find the true motifs.
A simple protein example:
```
      meme lipocalin.s -mod oops -maxw 20 -nmotifs 2
      
```
The -dna switch is absent, so MEME assumes the file lipocalin.s contains protein sequences. MEME searches for two motifs each of width less than or equal to 20. (Specifying -maxw 20 makes MEME run faster since it does not have to consider motifs longer than 20.) Each motif is assumed to occur in each of the sequences because the OOPS model is specified.
Another simple protein example:
```
      meme farntrans5.s -mod anr -maxw 40 -maxsites 50
      
```
MEME searches for a motif of width up to 40 with up to 50 occurrences in the entire training set. The ANR sequence model is specified, which allows each motif to have any number of occurrences in each sequence. This dataset contains motifs with multiple repeats of motifs in each sequence. This example is fairly time consuming due to the fact that the time required to initial the motif probability tables is proportional to <maxw> times <maxsites>. By default, MEME only looks for motifs up to 29 letters wide with a maximum total of number of occurrences equal to twice the number of sequences or 30, whichever is less.
A much faster protein example:
```
      meme farntrans5.s -mod anr -w 10 -maxsites 30 -nmotifs 3
      
```
This time MEME is constrained to search for three motifs of width exactly ten. The effect is to break up the long motif found in the previous example. The -w switch forces motifs to be *exactly* ten letters wide. This example is much faster because, since only one width is considered, the time to build the motif probability tables is only proportional to <maxsites>.
Splitting the sites into three:
```
      meme farntrans5.s -mod anr -maxw 12 -nsites 24 -nmotifs 3
      
```
This forces each motif to have 24 occurrences, exactly, and be up to 12 letters wide.
A larger protein example with E-value cutoff:
```
      meme adh.s -mod zoops -nmotifs 20 -evt 0.01
      
```
In this example, MEME looks for up to 20 motifs, but stops when a motif is found with E-value greater than 0.01. Motifs with large E-values are likely to be statistical artifacts rather than biologically significant.


	<dataset>	file containing sequences in FASTA format
	[-h]	print this message
	[-o <output dir>]	name of directory for output files will not replace existing directory
	[-oc <output dir>]	name of directory for output files will replace existing directory
	[-text]	output in text format (default is HTML)
	[-dna]	sequences use DNA alphabet
	[-protein]	sequences use protein alphabet
	[-mod oops\|zoops\|anr]	distribution of motifs
	[-nmotifs <nmotifs>]	maximum number of motifs to find
	[-evt <ev>]	stop if motif E-value greater than <evt>
	[-nsites <sites>]	number of sites for each motif
	[-minsites <minsites>]	minimum number of sites for each motif
	[-maxsites <maxsites>]	maximum number of sites for each motif
	[-wnsites <wnsites>]	weight on expected number of sites
	[-w <w>]	motif width
	[-minw <minw>]	minumum motif width
	[-maxw <maxw>]	maximum motif width
	[-nomatrim]	do not adjust motif width using multiple alignments
	[-wg <wg>]	gap opening cost for multiple alignments
	[-ws <ws>]	gap extension cost for multiple alignments
	[-noendgaps]	do not count end gaps in multiple alignments
	[-bfile <bfile>]	name of background Markov model file
	[-revcomp]	allow sites on + or - DNA strands
	[-pal]	force palindromes (requires -dna)
	[-maxiter <maxiter>]	maximum EM iterations to run
	[-distance <distance>]	EM convergence criterion
	[-psp <pspfile>]	name of positional priors file
	[-prior dirichlet\|dmix\|	type of prior to use
	mega\|megap\|addone]
	[-b <b>]	strength of the prior
	[-plib <plib>]	name of Dirichlet prior file
	[-spfuzz <spfuzz>]	fuzziness of sequence to theta mapping
	[-spmap uni\|pam]	starting point seq to theta mapping type
	[-cons <cons>]	consensus sequence to start EM from
	[-heapsize <hs>]	size of heaps for widths where substring
		search occurs
	[-x_branch]	perform x-branching
	[-w_branch]	perform width branching
	[-bfactor <bf>]	branching factor for branching search
	[-maxsize <maxsize>]	maximum dataset size in characters
	[-nostatus]	do not print progress reports to terminal
	[-p <np>]	use parallel version with <np> processors
	[-time <t>]	quit before <t> CPU seconds consumed
	[-sf <sf>]	print <sf> as name of sequence file
	[-V]	verbose mode