Sequence formats


The preferred sequence format for Meta-MEME is Fasta format. For example,
>ICYA_MANSE Insecticyanin A form blue biliprotein) 
GDIFYPGYCPDVKPVNDFDLSAFAGAWHEIAKLPLENENQGKCTIAEYKYDGKK
ASVYNSFVSNGVKEYMEGDLEIAPDA
>LACB_BOVIN Beta-lactoglobulin precursor (BETA-LG)
MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPL
RVYVEELKPTPEGDLEILLQKW
Sequences start with a header line followed by sequence lines. The header line begins with the character ">", followed by a unique name without any spaces, followed by (optional) descriptive text. After the header line come the actual sequence lines. Spaces and blank lines are ignored. Sequences may be in capital, lowercase or both.

The web version of Meta-MEME also accepts protein and DNA sequences in any of the following formats by converting them to Fasta format.


The Meta-MEME web site uses the ReadSeq program to read in sequences. ReadSeq is copyright 1990 by D. G. Gilbert, Biology Dept., Indiana University.
Return to the Meta-MEME home page.

Please send comments and questions to: .